DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and pqbp-1.1

DIOPT Version :9

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_499890.2 Gene:pqbp-1.1 / 176847 WormBaseID:WBGene00020647 Length:280 Species:Caenorhabditis elegans


Alignment Length:228 Identity:74/228 - (32%)
Similarity:111/228 - (48%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPKRRSVEEK 65
            |.||.|||.||:|||:|.::          ||:|||||:               .||:::|.|| 
 Worm     1 MPLPPALLARLQKRGIVKQE----------EEVIAENYE---------------KEPEKKSFEE- 39

  Fly    66 FWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKF-NSSPLSQPSHRYLKRYKRLLRKYP 129
                        |.:  |...||||:|.||.|..:|.:.: :.:|..:...||::...|:|.|:|
 Worm    40 ------------NSA--GAPGCPNKWNQYHVCLEFCYDHWGDGTPEYRLPERYVQNKNRMLAKFP 90

  Fly   130 LEAGWKDVYDKGCKAFYFYNSTTQTVSWLPPSHPKARITNSAAVFRRQLA-------NSNDEFNF 187
            |...|.:|||:|...:||:|.||..|.|..|.||:|.|::.|....|:.|       ::::|.|.
 Worm    91 LPENWVEVYDEGLAKYYFWNKTTDEVCWYSPRHPRAIISDPAPRIAREHATVLFGDSHASEEDNA 155

  Fly   188 --DTNMVQPKSSNQNEPDEPDVFVPAKKQKSRD 218
              ..|....|:|.....|:......|:|:|.||
 Worm   156 ARRRNFHNKKTSRGGNDDKQSRGNNAEKRKRRD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:278809 13/29 (45%)
pqbp-1.1NP_499890.2 WW 90..122 CDD:197736 14/31 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3427
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I3510
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48631
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006017
OrthoInspector 1 1.000 - - oto20097
orthoMCL 1 0.900 - - OOG6_106865
Panther 1 1.100 - - LDO PTHR21737
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10618
SonicParanoid 1 1.000 - - X4933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.