DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and PQBP1

DIOPT Version :10

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_005701.1 Gene:PQBP1 / 10084 HGNCID:9330 Length:265 Species:Homo sapiens


Alignment Length:241 Identity:57/241 - (23%)
Similarity:76/241 - (31%) Gaps:96/241 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPKRRSVEEK 65
            |.||.||..||.|||::....     .|..||||||:||||    |..|:               
Human     1 MPLPVALQTRLAKRGILKHLE-----PEPEEEIIAEDYDDD----PVDYE--------------- 41

  Fly    66 FWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKFNSSPLSQPSHRYLKRYKRLLRKYPL 130
                                                                      ..|...|
Human    42 ----------------------------------------------------------ATRLEGL 48

  Fly   131 EAGWKDVYDKGCKAFYFYNSTTQTVSWLPPSHPKARITNSAAVFRRQLANSN---DEFNFDTNMV 192
            ...|..|:|..|...|::|:.|..||||.|..|.:.:|.||...|...|::.   |..:..::..
Human    49 PPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRG 113

  Fly   193 QPKSSNQNEP-----DEPDVFVPAKKQKSRDLER---KIQRRRRND 230
            ..||...:|.     |:.|   ....:..||.||   |:.|.|..|
Human   114 HDKSDRSHEKLDRGHDKSD---RGHDKSDRDRERGYDKVDRERERD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:459800 12/29 (41%)
PQBP1NP_005701.1 WW 47..78 CDD:197736 1/30 (3%)
Disordered. /evidence=ECO:0000269|PubMed:19303059 94..265 34/148 (23%)
5 X 7 AA approximate tandem repeats of D-R-[SG]-H-D-K-S 104..138 3/33 (9%)
3 X 2 AA tandem repeats of [DE]-R 139..144 2/4 (50%)
7 X 2 AA tandem repeats of [DE]-R 150..163 6/12 (50%)
Important for interaction with TXNL4A 245..255
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.