DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PQBP1 and pqbp1

DIOPT Version :9

Sequence 1:NP_651331.1 Gene:PQBP1 / 43004 FlyBaseID:FBgn0039270 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001135500.1 Gene:pqbp1 / 100216040 XenbaseID:XB-GENE-6455289 Length:198 Species:Xenopus tropicalis


Alignment Length:221 Identity:53/221 - (23%)
Similarity:73/221 - (33%) Gaps:86/221 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLPAALLQRLKKRGLVTKQSGAAPISEAIEEIIAENYDDDDKSGPYPYKEDTSPEPKRRSVEEK 65
            |.||.||..||.|||::....     ||..||||||:||||...                     
 Frog     1 MPLPLALQARLAKRGILRHVD-----SEPAEEIIAEDYDDDHVD--------------------- 39

  Fly    66 FWSHRIKERIGVNESYHGYKLCPNKYNIYHKCSLYCVNKFNSSPLSQPSHRYLKRYKRLLRKYPL 130
                                              |...:..|.|   ||                
 Frog    40 ----------------------------------YEATRVESLP---PS---------------- 51

  Fly   131 EAGWKDVYDKGCKAFYFYNSTTQTVSWLPPSHPKARITNSAAVFRRQLANSNDEFNFDTNMVQPK 195
               |..|:|..|...|::|..|..|:||.|:.|.|.||.:||   :|.....:|...:...|..|
 Frog    52 ---WYKVFDPICGLPYYWNVETDLVAWLSPNDPGAVITRAAA---KQKVTEPEEKPLEREEVIMK 110

  Fly   196 SSNQNEPDEPDVFVPAKK-QKSRDLE 220
            ....:..:|...:..:|| :|..:|:
 Frog   111 ERRFSRREEVAPYPKSKKGRKEEELD 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PQBP1NP_651331.1 WW 130..160 CDD:278809 10/29 (34%)
pqbp1NP_001135500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5082
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006017
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.