DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and Lin7a

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_038936043.1 Gene:Lin7a / 85327 RGDID:621256 Length:244 Species:Rattus norvegicus


Alignment Length:218 Identity:116/218 - (53%)
Similarity:137/218 - (62%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYETVDIQGSHDVR 70
            :||||.|||.|:||||||||.||:.|..||.:|:|||.|:|.|::||||::::||:.:.|..:.|
  Rat    21 QPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFR 85

  Fly    71 ASATAKATVAAFAASEGHAHPRVVELPKTEEGKTRPYELRIEGIPLYHKTNTLIVKVYRPRIYVS 135
            |.||||||||||||||||:||||||||||:|                                  
  Rat    86 ARATAKATVAAFAASEGHSHPRVVELPKTDE---------------------------------- 116

  Fly   136 IIHLIWKALSIFNFCFSGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVE 200
                             |||||||||||||||||||||||||||:|||||||||||||||||::|
  Rat   117 -----------------GLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVALE 164

  Fly   201 GENHEKAVELLKQAVGSVKLVVR 223
                ||   |..|:..|.|...|
  Rat   165 ----EK---LAGQSSNSHKFGTR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918 28/51 (55%)
PDZ_signaling 153..223 CDD:238492 51/69 (74%)
Lin7aXP_038936043.1 L27 31..83 CDD:197794 28/51 (55%)
PDZ_signaling 106..>166 CDD:238492 55/114 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354281
Domainoid 1 1.000 135 1.000 Domainoid score I4837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 285 1.000 Inparanoid score I2769
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335138at2759
OrthoFinder 1 1.000 - - FOG0001780
OrthoInspector 1 1.000 - - otm45395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14063
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.