DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and MPP4

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_149055.2 Gene:MPP4 / 58538 HGNCID:13680 Length:637 Species:Homo sapiens


Alignment Length:214 Identity:56/214 - (26%)
Similarity:94/214 - (43%) Gaps:50/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LQKVLNSDFMTSVREVYEHVYETVDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEG 102
            |..:|:|.::.::.::|:.:.|..:.:     ...||..|.|.::         .||||  ..|.
Human    53 LYDLLHSPWLQALLKIYDCLQEFKEKK-----LVPATPHAQVLSY---------EVVEL--LRET 101

  Fly   103 KTRP--YELR-------IEGIPLYHKTNTLIVKVYRPRI------------YVSIIHLIWKALSI 146
            .|.|  .|||       .:.:...|  :|:..|.:.|.:            .:.|:.|:...   
Human   102 PTSPEIQELRQMLQAPHFKALLSAH--DTIAQKDFEPLLPPLPDNIPESEEAMRIVCLVKNQ--- 161

  Fly   147 FNFCFSGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELL 211
                 ..||..:. ..|....|.::|||.||:|:|.|.|..||:|:.||||||||.:.|:.:.:|
Human   162 -----QPLGATIK-RHEMTGDILVARIIHGGLAERSGLLYAGDKLVEVNGVSVEGLDPEQVIHIL 220

  Fly   212 KQAVGSV--KLVVRYTPKV 228
            ..:.|::  |:|....|.|
Human   221 AMSRGTIMFKVVPVSDPPV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918 5/27 (19%)
PDZ_signaling 153..223 CDD:238492 29/71 (41%)
MPP4NP_149055.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
L27 30..83 CDD:197794 5/34 (15%)
L27 90..140 CDD:197794 14/62 (23%)
PDZ_signaling 153..232 CDD:238492 30/87 (34%)
SH3_MPP4 246..306 CDD:212967
Guanylate_kin 428..618 CDD:331880
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.