DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and Pdlim3

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001361581.1 Gene:Pdlim3 / 53318 MGIID:1859274 Length:364 Species:Mus musculus


Alignment Length:85 Identity:27/85 - (31%)
Similarity:44/85 - (51%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVK 219
            ||.:.||.:.|.|:.|:||.||..| ....|..||.:|:::|...|...|..|.:.:|.|  |.:
Mouse    14 GFRLSGGIDFNQPLVITRITPGSKA-AAANLCPGDVILAIDGFGTESMTHADAQDRIKAA--SYQ 75

  Fly   220 LVVR--------YTPKVLEE 231
            |.::        ::|:|.|:
Mouse    76 LCLKIDRAETRLWSPQVSED 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918
PDZ_signaling 153..223 CDD:238492 24/67 (36%)
Pdlim3NP_001361581.1 PDZ_signaling 2..80 CDD:238492 24/68 (35%)
DUF4749 184..268 CDD:374237
LIM_ALP 294..346 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.