DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and a

DIOPT Version :10

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_524641.1 Gene:a / 43852 FlyBaseID:FBgn0000008 Length:1329 Species:Drosophila melanogaster


Alignment Length:91 Identity:27/91 - (29%)
Similarity:49/91 - (53%) Gaps:11/91 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LGFNVMGGKEQ---NSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAV 215
            |||:::||::.   |..|::..:.|.|.|...|.|:.||:::.:||.||:|.:|.:.:.|.|.  
  Fly  1244 LGFSIVGGRDSPKGNMGIFVKTVFPSGQAADDGTLQAGDEIVEINGNSVQGMSHAETIGLFKN-- 1306

  Fly   216 GSVKLVVRYTPKVLEEMEMRFDKQRN 241
                  ||....||:.:..:..|.::
  Fly  1307 ------VREGTIVLKILRRKLQKAKS 1326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:460717
PDZ_Lin-7-like 90..226 CDD:467258 24/74 (32%)
aNP_524641.1 PDZ_canonical <815..868 CDD:483948
PDZ3_PDZD2-PDZ1_hPro-IL-16-like 1231..1316 CDD:467240 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.