DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and MPP3

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001317162.1 Gene:MPP3 / 4356 HGNCID:7221 Length:610 Species:Homo sapiens


Alignment Length:257 Identity:59/257 - (22%)
Similarity:109/257 - (42%) Gaps:46/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DNAEPLTLSRD--VKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHV--YETVDI 63
            |||....||.|  :..::.||............::..|:.|.:...::.:.:::|.:  ||.   
Human    22 DNASMPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIHEKLRYYER--- 83

  Fly    64 QGSHDVRASATAKA--TVAAFAASEGHAHPR-VVELPKTEEGKTRPYELRIEGIPLYHKTNTLIV 125
            |....|..||.|.|  .:....|:..|:..| :::|..|      |:   :..:.:.|  :|:..
Human    84 QSPTPVLHSAVALAEDVMEELQAASVHSDERELLQLLST------PH---LRAVLMVH--DTVAQ 137

  Fly   126 KVYRPRI--------------YVSIIHLIWKALSIFNFCFSGLGFNVMGGKEQNSPIYISRIIPG 176
            |.:.|.:              .|.|:.|:...        ..||..:. ..|.:..:.::||:.|
Human   138 KNFDPVLPPLPDNIDEDFDEESVKIVRLVKNK--------EPLGATIR-RDEHSGAVVVARIMRG 193

  Fly   177 GVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEMEMRFDK 238
            |.|||.|.:..||:|..|||::|..:..::..::|.|:.||:.|  :..|...||..::..|
Human   194 GAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITL--KIIPATQEEDRLKESK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918 8/53 (15%)
PDZ_signaling 153..223 CDD:238492 23/69 (33%)
MPP3NP_001317162.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.