DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and gopc

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_956851.1 Gene:gopc / 326887 ZFINID:ZDB-GENE-030131-5086 Length:455 Species:Danio rerio


Alignment Length:283 Identity:66/283 - (23%)
Similarity:101/283 - (35%) Gaps:77/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AEPLTLSRDVKRSIELLE----KLQASGD-----------FPTTKLAALQKVLNSDFMTSVREV- 53
            ||.:.:.::|...:..|.    ||||.|.           .|...:...:|.|.:.....|:|| 
Zfish   109 AEKVVVEKEVHEQLLQLHAMQLKLQAKGGQAVDSDSIKDRMPVPSVEEKEKELEASKKEKVKEVK 173

  Fly    54 ---------------YEHV---------------YETVDIQG--------SHDVRASATAKATVA 80
                           ..|:               |...::.|        ..|::..|..|....
Zfish   174 LEAEVKMLKKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQ 238

  Fly    81 AFAASEGHAHPRVVELPKTEEGKTRPYELRIEGIPLYHKTNTLI----VKVYRPRIYVSIIHLIW 141
            ..|....|.|..|:...:......:|..     .|:.|.|::|.    |...|..:.....|   
Zfish   239 LEAEIHLHRHKTVIRACRGRNDPKKPLP-----SPVGHDTDSLKKTQGVGPIRKVVLTKEDH--- 295

  Fly   142 KALSIFNFCFSGLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEK 206
                      .|||.::.||||...||.||.|.|...|:|.|||..||.:|:||.:::....|::
Zfish   296 ----------EGLGISITGGKEHGVPILISEIHPTQPAERCGGLHVGDAILAVNNINLRDAKHKE 350

  Fly   207 AVELLKQAVGSVKLVVRY-TPKV 228
            ||.:|.|..|.::..|.| .|:|
Zfish   351 AVTILSQQRGEIEFEVVYVAPEV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918 16/105 (15%)
PDZ_signaling 153..223 CDD:238492 29/69 (42%)
gopcNP_956851.1 PDZ_signaling 285..367 CDD:238492 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.