DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and Pdzd11

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_038955522.1 Gene:Pdzd11 / 302422 RGDID:1560007 Length:145 Species:Rattus norvegicus


Alignment Length:130 Identity:42/130 - (32%)
Similarity:65/130 - (50%) Gaps:11/130 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PY-ELRIEGIPLYHKTNTLI---VKVYRPRIYVSIIHLIWKALSIFNFCFSGLGFNVMGGKEQNS 166
            || :..:..:|.|......|   .:||.|.....:...:.:.:::.....:.||||:.|||....
  Rat     6 PYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQL 70

  Fly   167 PIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEK-----AVELLKQAVGSVKLVVRYTP 226
            .|:||::||...|.| .||:.|||:|:||.|..:...|.|     |||:||.| ..:.:.||:.|
  Rat    71 GIFISKVIPDSDAHR-AGLQEGDQVLAVNDVDFQDIEHSKLCVFQAVEILKTA-REISMRVRFFP 133

  Fly   227  226
              Rat   134  133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918
PDZ_signaling 153..223 CDD:238492 31/74 (42%)
Pdzd11XP_038955522.1 PDZ_signaling 45..130 CDD:238492 31/86 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.