DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and ZK849.1

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_493476.1 Gene:ZK849.1 / 173288 WormBaseID:WBGene00014100 Length:331 Species:Caenorhabditis elegans


Alignment Length:83 Identity:22/83 - (26%)
Similarity:43/83 - (51%) Gaps:5/83 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GLGFNVMGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEG-ENHEKAVELL--KQA 214
            |||..:.||.:|..|:.::..:...:|| ...|:..|::|:::|..|.. ..|.:.:|:|  :.|
 Worm   225 GLGLEITGGCDQFRPVVVTGKLKRSMAD-DDQLRVNDRILAIDGTFVTNTTTHAEVMEMLENESA 288

  Fly   215 VGSVKLVV-RYTPKVLEE 231
            ...:.|:| ::.|....|
 Worm   289 KDFISLIVSQFDPTKYHE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918
PDZ_signaling 153..223 CDD:238492 20/73 (27%)
ZK849.1NP_493476.1 PDZ_signaling 212..296 CDD:238492 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.