DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment veli and Y54G11A.17

DIOPT Version :9

Sequence 1:NP_733076.2 Gene:veli / 43003 FlyBaseID:FBgn0039269 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001254426.1 Gene:Y54G11A.17 / 13187936 WormBaseID:WBGene00185067 Length:124 Species:Caenorhabditis elegans


Alignment Length:62 Identity:14/62 - (22%)
Similarity:23/62 - (37%) Gaps:23/62 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 HGGLK------RGDQLLSV--NGV---------------SVEGENHEKAVELLKQAVGSVKL 220
            |.||.      ||::||..  :|:               .::|..:.|.|:|.|.....:.|
 Worm    51 HPGLNVYYENDRGERLLRAHCDGIVRISQEKCDPDYEIEEMKGYEYRKDVDLYKMTFNVIPL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
veliNP_733076.2 L27 14..66 CDD:280918
PDZ_signaling 153..223 CDD:238492 14/62 (23%)
Y54G11A.17NP_001254426.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3550
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.