powered by:
Protein Alignment veli and Y54G11A.17
DIOPT Version :9
Sequence 1: | NP_733076.2 |
Gene: | veli / 43003 |
FlyBaseID: | FBgn0039269 |
Length: | 246 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254426.1 |
Gene: | Y54G11A.17 / 13187936 |
WormBaseID: | WBGene00185067 |
Length: | 124 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 14/62 - (22%) |
Similarity: | 23/62 - (37%) |
Gaps: | 23/62 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 182 HGGLK------RGDQLLSV--NGV---------------SVEGENHEKAVELLKQAVGSVKL 220
|.||. ||::||.. :|: .::|..:.|.|:|.|.....:.|
Worm 51 HPGLNVYYENDRGERLLRAHCDGIVRISQEKCDPDYEIEEMKGYEYRKDVDLYKMTFNVIPL 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
veli | NP_733076.2 |
L27 |
14..66 |
CDD:280918 |
|
PDZ_signaling |
153..223 |
CDD:238492 |
14/62 (23%) |
Y54G11A.17 | NP_001254426.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3550 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.