DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stac and syt9

DIOPT Version :10

Sequence 1:NP_651329.4 Gene:stac / 43002 FlyBaseID:FBgn0266719 Length:1153 Species:Drosophila melanogaster
Sequence 2:XP_002938083.2 Gene:syt9 / 100497543 XenbaseID:XB-GENE-1006053 Length:509 Species:Xenopus tropicalis


Alignment Length:43 Identity:12/43 - (27%)
Similarity:19/43 - (44%) Gaps:8/43 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 EDERPYEIVDLKEMSSPHKNHNVQSHFLNETNNLLTIEKHSET 268
            :||| ..|||:.::       .|....:....||.|:.:..||
 Frog   122 DDER-RNIVDVSKL-------GVTCIHIQNGMNLQTLSQGLET 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stacNP_651329.4 C2 152..317 CDD:472691 12/43 (28%)
MUN <637..1003 CDD:461870
C2B_Munc13-like 990..1116 CDD:175976
syt9XP_002938083.2 C2 219..342 CDD:472691
C2B_Synaptotagmin-3-5-6-9-10 352..485 CDD:176048
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.