DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and TBRG1

DIOPT Version :9

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_116200.2 Gene:TBRG1 / 84897 HGNCID:29551 Length:411 Species:Homo sapiens


Alignment Length:153 Identity:27/153 - (17%)
Similarity:59/153 - (38%) Gaps:29/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SPTDPLPKTICKSCLHRVEQHYSLLMRLTRMREERKFKLIKYKAQRNPSISSVESEEDVINS-SS 113
            ||..||..:..:            :.:|.:..:..|::| ||...|..:.::|.....:.:. :.
Human    10 SPRAPLQSSKAR------------MKKLPKKSQNEKYRL-KYLRLRKAAKATVFENAAICDEIAR 61

  Fly   114 VHEFPNRNEEDQATRRSESTSTQAETGPQTQESQSPKSTKTAVSTPNSSESHDASGAGP------ 172
            :.|...:.:|::.....:....||.|..:.|.:....|:...::...:|......||||      
Human    62 LEEKFLKAKEERRYLLKKLLQLQALTEGEVQAAAPSHSSSLPLTYGVASSVGTIQGAGPISGPST 126

  Fly   173 ---------SNRDRKETGTGNSE 186
                     :.:::||.|..|::
Human   127 GAEEPFGKKTKKEKKEKGKENNK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 4/25 (16%)
TBRG1NP_116200.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 5/30 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..146 5/26 (19%)
FYRN 189..238 CDD:283589
FYRC 244..319 CDD:283590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.