Sequence 1: | NP_001262946.1 | Gene: | CG31109 / 43001 | FlyBaseID: | FBgn0051109 | Length: | 198 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005250082.1 | Gene: | KMT2C / 58508 | HGNCID: | 13726 | Length: | 4983 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 63/204 - (30%) | Gaps: | 48/204 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IEKACISGFLCRLCSEMHRTVIHIYSDHGQRLCLVEKINGYLPITISPTDPLPKTICKSCLHRVE 68
Fly 69 QHYSLLMRLT-------RMREERKFKLIKYKA----QRNPSISSVESEEDVINSSSVHEF----- 117
Fly 118 -----PNRNEEDQATRRSESTSTQAETGPQTQESQSPKSTKTAVSTPNSSESHDASGAGPSNRDR 177
Fly 178 KETGTGNSE 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31109 | NP_001262946.1 | zf-AD | 13..76 | CDD:214871 | 11/62 (18%) |
KMT2C | XP_005250082.1 | ePHD1_KMT2C | 248..331 | CDD:277166 | |
PHD1_KMT2C_like | 344..389 | CDD:276984 | |||
PHD2_KMT2C | 391..436 | CDD:277069 | |||
PHD3_KMT2C | 467..518 | CDD:276986 | |||
PHD4_KMT2C | 953..1009 | CDD:277071 | |||
PHD5_KMT2C_like | 1010..1056 | CDD:276988 | |||
RanBP2-type Zn finger | 1085..1107 | CDD:275375 | |||
PHD6_KMT2C | 1087..1137 | CDD:277073 | 4/12 (33%) | ||
HMG-box | 1671..1722 | CDD:294061 | |||
DUF2962 | 1709..>1792 | CDD:288077 | |||
SYCE1 | <3198..3287 | CDD:291886 | |||
ePHD2_KMT2C | 4474..4578 | CDD:277167 | |||
FYRN | 4624..4674 | CDD:283589 | |||
FYRC | 4680..4761 | CDD:283590 | |||
SET | <4797..4983 | CDD:225491 | |||
SET | 4844..4965 | CDD:214614 | |||
PostSET | 4967..4983 | CDD:214703 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4443 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |