DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and Tbrg1

DIOPT Version :9

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001009344.2 Gene:Tbrg1 / 300521 RGDID:1305123 Length:406 Species:Rattus norvegicus


Alignment Length:125 Identity:26/125 - (20%)
Similarity:52/125 - (41%) Gaps:13/125 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LMRLTRMREERKFKLIKYKAQRNPSISSVESEEDVINS-SSVHEFPNRNEEDQATRRSESTSTQA 137
            :.||.:..:..|::| ||...|..:.::|.....|.:. :.:.|...:.:|::.....:.....|
  Rat    21 MKRLPKKNQNEKYRL-KYLRLRRAAKATVFENAAVCDEIARLEEKFLKAKEERRYLLKKLLQIHA 84

  Fly   138 ETGPQTQESQSPKSTKTAVSTPNSSESHDASGAGP-----------SNRDRKETGTGNSE 186
            .|..:.|.:....|:...::...:|......||||           |.:::||.|..||:
  Rat    85 LTEGEPQAAAPSHSSSLPLAYGVTSSVGTIQGAGPSTGAEEPFAKKSKKEKKEKGKENSK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 0/1 (0%)
Tbrg1NP_001009344.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..144 9/27 (33%)
FYRN 183..233 CDD:399155
FYRC 239..320 CDD:399156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.