DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31109 and set-16

DIOPT Version :9

Sequence 1:NP_001262946.1 Gene:CG31109 / 43001 FlyBaseID:FBgn0051109 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_499819.3 Gene:set-16 / 176802 WormBaseID:WBGene00011729 Length:2475 Species:Caenorhabditis elegans


Alignment Length:220 Identity:46/220 - (20%)
Similarity:71/220 - (32%) Gaps:47/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KACISGFLCRLCSEMHRTVIHIYSDHGQRLCLVEKINGYLPITISPTDPLPKTICKSCLHRVEQH 70
            :.|.....|..|..|      |.:|  .|.|...:.:.:|....|....|...:|.||..|.:..
 Worm    35 RQCDMSSSCGSCQRM------ITAD--SRQCTTCRKSYHLSCDSSDVSSLNNFVCISCRRRSQML 91

  Fly    71 YSLLMRLTRMREER------------KFKLIKYKAQRNPSISSVESEEDVINS--SSVHEFPNRN 121
            ...:|.....|..|            ....|..:.|..|..||....:|....  :.:.....:.
 Worm    92 PDDVMLSASARPSRGQDAPLSPFSDPSVPQISLQMQPAPLPSSYPRSQDFNGDVYTQIAAMQQQR 156

  Fly   122 EEDQATRRSESTSTQAE------TGPQTQESQSPKSTKTAVSTPNSSESHD---------ASGAG 171
            ::.|..:..:..:|||:      .|..|.:|...       |:|...|:.|         ..|.|
 Worm   157 QQQQQNQVQQMLATQAQLMDEISDGGGTNDSDRN-------SSPFYQEASDYDEDFVPASTRGRG 214

  Fly   172 PSNRDRKETGTGNSETGSTTREGTH 196
            .....:|:.|.|.| ||  ||..|:
 Worm   215 RGGGAKKKPGRGGS-TG--TRRQTN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31109NP_001262946.1 zf-AD 13..76 CDD:214871 14/62 (23%)
set-16NP_499819.3 PHD_SF 42..84 CDD:276966 11/49 (22%)
PHD4_KMT2C_like 427..477 CDD:276987
PHD5_KMT2C_like 479..524 CDD:276988
PHD6_KMT2C_like 554..604 CDD:276989
DUF1351 1060..>1163 CDD:284492
ePHD2_KMT2C_like 1904..2008 CDD:277136
FYRN 2055..2104 CDD:283589
FYRC 2112..2199 CDD:197781
SET 2333..2457 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.