DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and EPS1

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_012261.1 Gene:EPS1 / 854812 SGDID:S000001267 Length:701 Species:Saccharomyces cerevisiae


Alignment Length:318 Identity:54/318 - (16%)
Similarity:101/318 - (31%) Gaps:112/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QDLRRVDDTELIQLLTGSSNVVVLFNKNNCQRCVEYEN--------------------------- 57
            :|::..||:               ....||.:|.|::.                           
Yeast   186 KDMKNSDDS---------------LEFKNCDKCHEFQRTWKIISRQLAVDDINTGHVNCESNPTI 235

  Fly    58 ----------MVTKIRAQLEETLSAIVVQSVDSNLVSI---YDPSKEPALVFFRR-----GIPIL 104
                      .:|..||..|..::.::.....:||...   |....:..:.|.||     ..|.:
Yeast   236 CEELGFGDLVKITNHRADREPKVALVLPNKTSNNLFDYPNGYSAKSDGYVDFARRTFTNSKFPNI 300

  Fly   105 YHGEI----NDDEILDFF--------ND-----NLEPAVKELSD-DNFEHLTQASSGATTGDWFI 151
            ..||:    |.|  :||.        ||     :.:|....:.| |..|:|.:..|....    |
Yeast   301 TEGELEKKANRD--IDFLQERGRVTNNDIHLVFSYDPETVVIEDFDILEYLIEPLSKIPN----I 359

  Fly   152 FFSSAECTVCQRLYAVWESVGGKLKRKLNIAR------MNSLESGISTATRLGVLEAPAFIFLRQ 210
            :....:    :.|..:..::.|::..|:|...      .|.....::|.|:|     |.|...:.
Yeast   360 YLHQID----KNLINLSRNLFGRMYEKINYDASQTQKVFNKEYFTMNTVTQL-----PTFFMFKD 415

  Fly   211 GKMYKYSAKQYSPEAFVQFAEKGYTQSHPQPVPAIPSAVNEFLGPLQSYFAAENITSL 268
            |          .|   :.:...||:.:..:.:.||...|.::..||.:...:.|:..|
Yeast   416 G----------DP---ISYVFPGYSTTEMRNIDAIMDWVKKYSNPLVTEVDSSNLKKL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 18/109 (17%)
EPS1NP_012261.1 Thioredoxin 33..139 CDD:395038
PTZ00102 <404..>472 CDD:240266 15/75 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.