DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and MPD2

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_014553.1 Gene:MPD2 / 854065 SGDID:S000005448 Length:277 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:30/131 - (22%)
Similarity:47/131 - (35%) Gaps:51/131 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DTELIQLLTGSSNVVVLFN-------KNNCQRCVEY-----ENMVTKIRAQ----------LEET 69
            ||..:....||.|:..|.|       |:..:|.:|:     .|...::|:|          ..:|
Yeast   150 DTSRVVRFEGSRNLKSLSNFIDTVRSKDTEERFIEHIFDDSRNCNEELRSQQLLCKAGKEYYSDT 214

  Fly    70 LS-----------------AIVVQSVDSNLVSIYDPSKE--PALVFFRRGIPILYHGEINDDEIL 115
            ||                 |::.|:.|       |.|||  ..|...|..:.:|.|.|   |::.
Yeast   215 LSKLYGDVNGLEKERRRLEALIKQNGD-------DLSKEVKEKLKIIRLQLSLLSHIE---DQLE 269

  Fly   116 D 116
            |
Yeast   270 D 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259
MPD2NP_014553.1 Thioredoxin_like <48..170 CDD:412351 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.