DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and PDIL5-1

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001318951.1 Gene:PDIL5-1 / 837311 AraportID:AT1G07960 Length:146 Species:Arabidopsis thaliana


Alignment Length:94 Identity:27/94 - (28%)
Similarity:46/94 - (48%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 WFIFFSSAECTVCQRLYAVWESVGGKLKRKLNIARMNSLESGISTA--TRLGVLEAPAFIFLRQG 211
            ||:.|....|..|::|..:||.:|..::....| .:..::.|.|.|  |::.:...|.|:....|
plant    46 WFVKFCVPWCKHCKKLGNLWEDLGKAMEGDDEI-EVGEVDCGTSRAVCTKVEIHSYPTFMLFYNG 109

  Fly   212 -KMYKYSAKQ--YSPEAFV-----QFAEK 232
             ::.||..|:  .|.:|||     :.|||
plant   110 EEVSKYKGKRDVESLKAFVVEETEKAAEK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 24/90 (27%)
PDIL5-1NP_001318951.1 Thioredoxin_like 27..128 CDD:412351 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1481386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.