DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and TXNDC5

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_110437.2 Gene:TXNDC5 / 81567 HGNCID:21073 Length:432 Species:Homo sapiens


Alignment Length:255 Identity:62/255 - (24%)
Similarity:100/255 - (39%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LTGSSNVVVLFNK--NNCQRCVEYENMVTKIRAQLEETLSAIVVQSVD----SNLVSIYDPSKEP 92
            :..:::.|:.|..  .:|||.....|.:......:|:  :.:.|..||    |::.|.......|
Human    75 IQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMED--AKVYVAKVDCTAHSDVCSAQGVRGYP 137

  Fly    93 ALVFFRRG-IPILYHG----EINDDEILDFFND---NLEPAVK------------ELSDDNFE-H 136
            .|..|:.| ..:.|.|    :..::.:|...|:   ..||.|:            |||..||| |
Human   138 TLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELH 202

  Fly   137 LTQASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKR-------KLNIARMNSLESGISTA 194
            :.|       ||.||.|.:..|..|:.|...||.:...|:.       |::..:...|.||..  
Human   203 VAQ-------GDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQ-- 258

  Fly   195 TRLGVLEAPAFIFLRQGK---MYK-----YSAKQYSPEAFVQFAEKGYTQS-HPQPVPAI 245
                |...|..::.|.||   .||     .|.::| .|:.:|..|.|.|:: .|...|.:
Human   259 ----VRGYPTLLWFRDGKKVDQYKGKRDLESLREY-VESQLQRTETGATETVTPSEAPVL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 34/130 (26%)
TXNDC5NP_110437.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..63
PDI_a_ERp46 61..164 CDD:239303 18/90 (20%)
ER_PDI_fam 66..432 CDD:273457 62/255 (24%)
PDI_a_ERp46 190..290 CDD:239303 32/113 (28%)
PDI_a_ERp46 323..424 CDD:239303
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 429..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.