DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and TMX1

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_110382.3 Gene:TMX1 / 81542 HGNCID:15487 Length:280 Species:Homo sapiens


Alignment Length:205 Identity:47/205 - (22%)
Similarity:85/205 - (41%) Gaps:55/205 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VKELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESV---GGKLKRKLNIARMNSL 187
            |:.::|:|:..|.:       |||.|.|.:..|..||.|...|||.   |..|  ::|||:::..
Human    31 VRVITDENWRELLE-------GDWMIEFYAPWCPACQNLQPEWESFAEWGEDL--EVNIAKVDVT 86

  Fly   188 ES-GISTATRLGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQF-AEKGYTQSHPQPVPAIPSAVN 250
            |. |:|  .|..:...|.....:.|:..:|...: :.:.|:.| ::|.:....|         |:
Human    87 EQPGLS--GRFIITALPTIYHCKDGEFRRYQGPR-TKKDFINFISDKEWKSIEP---------VS 139

  Fly   251 EFLGP--------------------LQSYFAAE-NITSLATLSIFALVAL---LFVGKKVAKIFS 291
            .:.||                    ..:||..: .:....:.::|||..|   |.:|  :..||.
Human   140 SWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLG--LCMIFV 202

  Fly   292 SE---PAKTK 298
            ::   |:|.:
Human   203 ADCLCPSKRR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 29/107 (27%)
TMX1NP_110382.3 PDI_a_TMX 29..129 CDD:239292 30/109 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..280
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1481386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.