Sequence 1: | NP_651326.1 | Gene: | CG11790 / 42999 | FlyBaseID: | FBgn0039265 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025330.1 | Gene: | tmx4 / 792311 | ZFINID: | ZDB-GENE-050706-155 | Length: | 277 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 41/198 - (20%) |
---|---|---|---|
Similarity: | 82/198 - (41%) | Gaps: | 32/198 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 VKELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKL-KRKLNIARMN-SLE 188
Fly 189 SGISTATRLGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQFAEKGYTQSHPQPVPAIPSA----- 248
Fly 249 ------VNEFLGPLQSYFA-AENITSLATLSIFALVALLFVGKKVAK--------IFSSEPAKTK 298
Fly 299 NKS 301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11790 | NP_651326.1 | PDI_a_family | 127..230 | CDD:239259 | 24/104 (23%) |
tmx4 | NP_001025330.1 | Thioredoxin_like | 29..129 | CDD:294274 | 25/106 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1481386at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |