Sequence 1: | NP_651326.1 | Gene: | CG11790 / 42999 | FlyBaseID: | FBgn0039265 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082615.1 | Gene: | Tmx1 / 72736 | MGIID: | 1919986 | Length: | 278 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 48/205 - (23%) |
---|---|---|---|
Similarity: | 85/205 - (41%) | Gaps: | 44/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 ALVFFRRGIPILYHGEINDDEILDFFNDNLEPAVKELSDDNFEHLTQASSGATTGDWFIFFSSAE 157
Fly 158 CTVCQRLYAVWESV---GGKLKRKLNIARMNSLE-SGISTATRLGVLEAPAFIFLRQGKMYKYSA 218
Fly 219 KQYSPEAFVQF-AEKGYTQSHPQPVPAIPSAV-----------NEFLGPLQSYFAAE-NITSLAT 270
Fly 271 LSIFALVALL 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11790 | NP_651326.1 | PDI_a_family | 127..230 | CDD:239259 | 28/107 (26%) |
Tmx1 | NP_082615.1 | PDI_a_TMX | 30..129 | CDD:239292 | 29/124 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 217..278 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1481386at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |