DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and Pdia5

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_082571.1 Gene:Pdia5 / 72599 MGIID:1919849 Length:517 Species:Mus musculus


Alignment Length:254 Identity:47/254 - (18%)
Similarity:96/254 - (37%) Gaps:55/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QDLRRVDDTELIQLLTGSSNVVVLFNKNNCQRC----VEYENMVTKIRAQLEETLSAI-VVQSVD 79
            :|.||:...|...||       ::|....|..|    ..::...|::|..:  .|:.: |..|..
Mouse   158 KDFRRLLKREEKPLL-------MMFYAPWCSMCKRIMPHFQKAATQVRGHI--VLAGMNVYPSEF 213

  Fly    80 SNLVSIYDPSKEPALVFFRRG---IPILYHGEINDDEILDFFNDNLEP--------------AVK 127
            .|:...|:....|.:.:|.:|   .|...:|...:| |:::..:.|.|              :|.
Mouse   214 ENIKEEYNVRGYPTICYFEKGRFLFPYENYGSTAED-IVEWLKNPLPPQPQVPETPWADEGGSVY 277

  Fly   128 ELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKRKLNIARMNSLESGIS 192
            .|:|::|:...:..|..     .:.|.:..|..|:::...:||..       .:...::..||:.
Mouse   278 HLTDEDFDQFVKEHSSV-----LVMFHAPWCGHCKKMKPEFESAA-------EVLHGDAESSGVL 330

  Fly   193 TATRLGVLEA----------PAFIFLRQGKMYKYSAKQYSPEAFVQFAEKGYTQSHPQP 241
            .|....|.||          |...:.:.|:.....|.: :.:.|:::.:.......|:|
Mouse   331 AAVDATVNEALAGRFHISAFPTLKYFKNGEQQAVPALR-TKKKFIEWMQNPEAPPPPEP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 19/112 (17%)
Pdia5NP_082571.1 PDI_b_PDIR_N 26..137 CDD:239365
PTZ00102 122..517 CDD:240266 47/254 (19%)
PDI_a_PDIR 150..254 CDD:239295 23/105 (22%)
PDI_a_PDIR 275..377 CDD:239295 20/114 (18%)
PDI_a_PDIR 396..499 CDD:239295
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.