DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and Pdia6

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_082235.2 Gene:Pdia6 / 71853 MGIID:1919103 Length:440 Species:Mus musculus


Alignment Length:294 Identity:58/294 - (19%)
Similarity:93/294 - (31%) Gaps:104/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LLTGSSNVVVL----FNK------------------NNCQRCV-EYENMVTKIRAQLEETLSAIV 74
            |.:.|.:|:.|    ||:                  .:|||.. |::...|.::       ..:.
Mouse    20 LYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALK-------DVVK 77

  Fly    75 VQSVDS----NLVSIYDPSKEPALVFF--RRGIPILYHGEINDDEILDFFNDNLEPAVK------ 127
            |.:|::    :|...|.....|.:..|  .:..|..|.|....:.|:|.....|...||      
Mouse    78 VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGR 142

  Fly   128 ---------------------ELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVW--- 168
                                 ||:||.|:.....|...    |.:.|.:..|..|:.|...|   
Mouse   143 SGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDV----WMVEFYAPWCGHCKNLEPEWAAA 203

  Fly   169 -----ESVGGKLKRKLNIARMNSLESGISTATRLGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQ 228
                 |...||:|.....|.||.:     .|:|.|:...|.....::|:         ||..:  
Mouse   204 ATEVKEQTKGKVKLAAVDATMNQV-----LASRYGIKGFPTIKIFQKGE---------SPVDY-- 252

  Fly   229 FAEKGYTQ-----------SHPQPVPAIPSAVNE 251
              :.|.|:           |...|.|.:...:||
Mouse   253 --DGGRTRSDIVSRALDLFSDNAPPPELLEIINE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 27/137 (20%)
Pdia6NP_082235.2 PDI_a_P5 26..128 CDD:239299 20/108 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..161 0/21 (0%)
PDI_a_P5 161..266 CDD:239299 28/126 (22%)
P5_C 275..404 CDD:239281 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..440
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 437..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.