DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and Erp27

DIOPT Version :10

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_081259.1 Gene:Erp27 / 69187 MGIID:1916437 Length:272 Species:Mus musculus


Alignment Length:135 Identity:27/135 - (20%)
Similarity:54/135 - (40%) Gaps:38/135 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QDLRRVDDTELIQLLTGSSNVVVLFNKNNCQRCVEYENMVTKIRAQLEETLSAIVVQSVDSNLVS 84
            :|:..:|..:|.:.:          :.||.....||..|   |.|.|..|:       |.::|:.
Mouse   122 EDIENLDAAKLSRFI----------HVNNLHWVTEYSPM---IAAGLFNTM-------VQTHLLL 166

  Fly    85 IY---DPSKEPALVFFRRGIPILYHGEI----------NDDEILDFF--NDNLEP--AVKELSDD 132
            :.   .|..|.::..:|.... |:.|:|          .:.:::.:|  .::..|  |:.|..||
Mouse   167 MMKKTSPEYEESMRRYREAAK-LFQGQILFVLVDSGKRENGKVMSYFKLKESQLPALAIYESVDD 230

  Fly   133 NFEHL 137
            .::.|
Mouse   231 KWDTL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PTZ00102 27..>174 CDD:240266 25/128 (20%)
PTZ00443 125..302 CDD:185622 5/13 (38%)
Erp27NP_081259.1 Thioredoxin_6 64..250 CDD:463999 27/135 (20%)
PDIA3-binding site. /evidence=ECO:0000250|UniProtKB:Q96DN0 230..233 1/2 (50%)
Prevents secretion from ER. /evidence=ECO:0000250|UniProtKB:Q96DN0 269..272
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.