DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and TXNDC16

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_065835.2 Gene:TXNDC16 / 57544 HGNCID:19965 Length:825 Species:Homo sapiens


Alignment Length:292 Identity:61/292 - (20%)
Similarity:105/292 - (35%) Gaps:74/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LTGSSNVVVLFNKNNCQRCVEYENMVTKIRAQLEETLSAIVVQSVD------SNLVSIYDPSKE- 91
            |.|.:.|::|...:......:..|:|.| ||:....:..:|:..||      .|.:.|.:..:: 
Human   297 LLGKAGVLLLLRDSLEVNIPQDANVVFK-RAEEGVPVEFLVLHDVDLIISHVENNMHIEEIQEDE 360

  Fly    92 ------PALVFFRRGIPILYHGEINDDEILD-FFNDN-----LEPAVKELSDDNFEHLTQASSGA 144
                  |.:             ::.|||:.: .|.|.     ||..| ||:::.|.....||   
Human   361 DNDMEGPDI-------------DVQDDEVAETVFRDRKRKLPLELTV-ELTEETFNATVMAS--- 408

  Fly   145 TTGDWFIFFSSAECTVCQRLYAVWES-----------VGGKLK--RKLNIARMNSLESGISTATR 196
               |..:.|           ||.|::           |..|||  ..:.:.|:|..:.. ...|:
Human   409 ---DSIVLF-----------YAGWQAVSMAFLQSYIDVAVKLKGTSTMLLTRINCADWS-DVCTK 458

  Fly   197 LGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQFAEKGYTQSHPQPVPAIPSAVNEFLGPLQSYFA 261
            ..|.|.|.....::|:.....|.....|..::|.:.... |:|..:.:|..|        :.|.:
Human   459 QNVTEFPIIKMYKKGENPVSYAGMLGTEDLLKFIQLNRI-SYPVNITSIQEA--------EEYLS 514

  Fly   262 AENITSLATLSIFALVALLFVGKKVAKIFSSE 293
            .|....|...|..:::.|.....|.||...||
Human   515 GELYKDLILYSSVSVLGLFSPTMKTAKEDFSE 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 23/115 (20%)
TXNDC16NP_065835.2 PDI_a_family 394..492 CDD:239259 24/116 (21%)
Thioredoxin_6 533..722 CDD:290560 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..787
Mediates endoplasmic reticulum retention. /evidence=ECO:0000269|PubMed:25122923 816..819
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.