DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and dnajc10

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001077016.1 Gene:dnajc10 / 557858 ZFINID:ZDB-GENE-070327-1 Length:791 Species:Danio rerio


Alignment Length:109 Identity:27/109 - (24%)
Similarity:47/109 - (43%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SVDSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNLEPAVKELSDDNFEHLTQAS 141
            ::...|.:.|:....|..|.|.:.....|.|..:.|.||:|..|.:.|.|..|..::|:.|.:..
Zfish   505 TIHEGLCNTYNIHAYPTTVIFNKSSIHEYEGHHSADGILEFIEDLVNPVVVTLGPESFQELVKRR 569

  Fly   142 SGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKRKLNIARMN 185
            ..:.|  |.:.|.:..|..||.|...|..:...|...:|:..::
Zfish   570 KSSET--WMVDFYAPWCGPCQALLPEWRRMARMLSGIVNVGTVD 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 13/59 (22%)
dnajc10NP_001077016.1 DnaJ 33..>129 CDD:223560
DnaJ 33..95 CDD:278647
PDI_a_ERdj5_N 128..228 CDD:239301
ER_PDI_fam 129..648 CDD:273457 27/109 (25%)
Thioredoxin_like <276..318 CDD:294274
PDI_a_family 348..443 CDD:239259
PDI_a_ERdj5_C 450..546 CDD:239302 10/40 (25%)
PDI_a_ERdj5_C 552..660 CDD:239302 15/62 (24%)
PDI_a_ERdj5_C 666..772 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.