DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and txndc16

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_685017.4 Gene:txndc16 / 556973 ZFINID:ZDB-GENE-100712-1 Length:804 Species:Danio rerio


Alignment Length:323 Identity:63/323 - (19%)
Similarity:110/323 - (34%) Gaps:83/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHIVSVVIIALSLGCAVGQDLRRVDDTELI-----QLLTGSSNVVVLFNKNNCQRCV---EYEN 57
            |..|.|.|.:|.::....|.:|..||..|..     |.:|....|::.     |.:..   .|..
Zfish   419 MAFIQSYVEVAEAVEDVNGVELAAVDCGEWTDICRDQNITSFPTVLIY-----CPKAAAAQPYRG 478

  Fly    58 MV-TKIRAQLEETLSAIVVQSVDSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDN 121
            |: ||       :|...::.|:.|..|.:   |....::.|..|.....:..:....:|..|:  
Zfish   479 MMGTK-------SLQRFILLSLVSTPVHL---SSSAEVMSFLEGDLYRKYVYLTPVRVLGLFS-- 531

  Fly   122 LEPAVKELSDDNFEHLTQASSGATTGDWFIFFSSAECT--VCQRLYAVWESVGGKLKRKLNIARM 184
               :::::...:||...:...|.|....|....:|:..  :...|.|:..|.|..|..     ::
Zfish   532 ---SMQDMGVSSFEEAARLLRGETIIGLFAHKEAAKWVEGLSVNLPALLVSHGPALPH-----QV 588

  Fly   185 NSLESGIST-------------ATRLGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQFAE----- 231
            .||.|.::|             ...|.|...|.::.|.:..:..:..|:.|.|:....||     
Zfish   589 FSLPSSLATDHVKLIQRVELERFPELTVENLPWYLELEKPLLLLFIGKEESTESTRSLAEINQLL 653

  Fly   232 ---------------------KGYTQSHPQPVPAIPSAV--------NEFLGPLQSYFAAENI 265
                                 :...:.:...||.:||.|        ..||.|.:....||||
Zfish   654 GSGQLDFFLPCWIHLGRTPVGRSILEKYLGFVPPLPSLVISQIKTGGEVFLFPSERPLKAENI 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 22/117 (19%)
txndc16XP_685017.4 PDI_a_family 389..489 CDD:239259 19/81 (23%)
Thioredoxin_6 530..722 CDD:290560 37/197 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.