DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and pdia5

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001107048.1 Gene:pdia5 / 556162 ZFINID:ZDB-GENE-030521-5 Length:528 Species:Danio rerio


Alignment Length:364 Identity:76/364 - (20%)
Similarity:133/364 - (36%) Gaps:111/364 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHIVSVVIIALSL-GCAVGQDLRRVDD-TELIQLLTGSSNVVVLFNKNNCQRCVEYENMVTKIR 63
            |...:|:|.:..:| ...|...:.:|:| .:..:||...:||:||:.|:           .:...
Zfish    16 MFIFLSLVAVTSALQAVKVSPLIEKVNDHKDFKKLLRTRTNVLVLYTKS-----------ASSGD 69

  Fly    64 AQLEETLSAIVVQSV------------DS------NLVSIYDPSKEPALVFFRRGIPIL------ 104
            |.|:  |.:.|.|:|            ||      ..|.: |||.:      .:|:.:|      
Zfish    70 AHLK--LLSDVAQAVKGQGTIAWVNCGDSEGRKLCKKVKV-DPSSK------TKGVELLHYKDGT 125

  Fly   105 YHGEIND----DEILDFFND-------NLEPAVKEL----SDDNFEHLTQASSGATTGDWFIFFS 154
            :|.|.|.    ..::.|..|       ...|..|::    |:.:|..|.:......    .:.|.
Zfish   126 FHTEYNRPATFKSMVAFLKDPAGAPLWEENPEAKDVVHIESEKDFRKLLKREERPI----LMMFY 186

  Fly   155 SAECTVCQRLYAVWESVGGKLKRKLNIARMNSLESGISTATRLGVLEA------PAFIFLRQGKM 213
            :..|.||:|:..:::....:.|.|..:|.||     :..|...||.:.      |.|.:..:|| 
Zfish   187 APWCGVCKRMQPIFQQAATETKGKYVLAGMN-----VHPAEFDGVKQEFSVKGYPTFCYFEKGK- 245

  Fly   214 YKYSAKQYSPEAFVQFAEKGYTQ--SHPQP----VPAIP-----SAVNEFLGPLQSYFAAENITS 267
            :.:..:.|..      ..|..|.  .:|||    .|.:|     |||..........|..|:.::
Zfish   246 FLHHYENYGA------TSKDITDWLKNPQPPQPKTPEVPWSESGSAVFHLTDDSFDSFLEEHPSA 304

  Fly   268 LATLSIFALVALLFVG------KKVAKIFSSEPAKTKNK 300
            |          ::|..      ||:...: .:.|:|.||
Zfish   305 L----------IMFYAPWCGHCKKMKPEY-DDAAETLNK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 22/112 (20%)
pdia5NP_001107048.1 PDI_b_PDIR_N 36..147 CDD:239365 28/130 (22%)
PDI_a_PDIR 160..264 CDD:239295 23/119 (19%)
ER_PDI_fam 181..512 CDD:273457 38/179 (21%)
PDI_a_PDIR 285..388 CDD:239295 12/59 (20%)
PDI_a_PDIR 407..510 CDD:239295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.