DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and DNAJC10

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_061854.1 Gene:DNAJC10 / 54431 HGNCID:24637 Length:793 Species:Homo sapiens


Alignment Length:245 Identity:59/245 - (24%)
Similarity:96/245 - (39%) Gaps:35/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SVDSNLVSIYDPSKEPALVFFRRGIPILYHGEINDDEILDFFNDNLEPAVKELSDDNFEHL-TQA 140
            :|...|.::|:....|..|.|.:.....|.|..:.::||:|..|.:.|:|..|:...|..| ||.
Human   509 TVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVSLTPTTFNELVTQR 573

  Fly   141 SSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKRKLNIARMNSLESGISTATRLGVLEAPAF 205
            .....   |.:.|.|..|..||.|...|:.:...|...:|:..:: .:...|...:..|...|..
Human   574 KHNEV---WMVDFYSPWCHPCQVLMPEWKRMARTLTGLINVGSID-CQQYHSFCAQENVQRYPEI 634

  Fly   206 IFL--RQGKMYKY-SAKQYSPEAF------VQFAEKGYTQSHPQPV-PAIPSAVNEFL------- 253
            .|.  :..|.|.| |...::.:|:      :.|..:..|...||.. ..:....|.::       
Human   635 RFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPW 699

  Fly   254 -GPLQSYFAAENITSLATLSIFALVALLFVGK-KVAKIFSSEPAKTKNKS 301
             ||.|: ||.|          |.|:|.:..|| |..|:.....|:|..|:
Human   700 CGPCQN-FAPE----------FELLARMIKGKVKAGKVDCQAYAQTCQKA 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 24/112 (21%)
DNAJC10NP_061854.1 DnaJ 34..>132 CDD:223560
PDI_a_ERdj5_N 129..229 CDD:239301
Trxb 1 235..350
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302 10/40 (25%)
PDI_a_ERdj5_C 556..663 CDD:239302 26/110 (24%)
PDI_a_ERdj5_C 670..775 CDD:239302 20/80 (25%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.