DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11790 and CG14695

DIOPT Version :9

Sequence 1:	NP_651326.1	Gene:	CG11790 / 42999	FlyBaseID:	FBgn0039265	Length:	302	Species:	Drosophila melanogaster
Sequence 2:	NP_650032.1	Gene:	CG14695 / 41314	FlyBaseID:	FBgn0037850	Length:	289	Species:	Drosophila melanogaster

Alignment Length:	73	Identity:	18/73 - (24%)
Similarity:	33/73 - (45%)	Gaps:	3/73 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 ALSLGCAVGQDLRRVDDTELIQLLTGSSNVVVLFNKNNCQRCVEYENMVTK-IRAQLEETLSAIV 74
            |:.||.....|.:.::..||.:  ..||:::|:.....|......:.|:.| ||....|.|..::
  Fly   143 AVVLGATASLDSKPMNYFELRE--ESSSDMLVMLYDPACYYWPIQKRMLRKLIRLLASEDLPIVI 205

  Fly    75 VQSVDSNL 82
            |...::.|
  Fly   206 VDKANNYL 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
CG11790	NP_651326.1	PDI_a_family	127..230	CDD:239259
CG14695	NP_650032.1	Thioredoxin_6	<20..134	CDD:290560
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0191
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900