DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and txndc5

DIOPT Version :10

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_989186.1 Gene:txndc5 / 394794 XenbaseID:XB-GENE-490945 Length:405 Species:Xenopus tropicalis


Alignment Length:197 Identity:41/197 - (20%)
Similarity:73/197 - (37%) Gaps:40/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CQRCVEYENMVTKIRAQLEETLSAIVVQSVD----SNLVSIYDPSKEPALVFFRRGIPI-LYHGE 108
            |..|........::.|..::: ::|.:..||    :.|.|.......|.|::||.|..: .|.|:
 Frog   190 CGHCKALAPAWEQLAATFQDS-NSIKIAKVDCTQHNGLCSDNQVRGYPTLLWFRNGEKVDQYKGK 253

  Fly   109 INDDEILDFFNDNLEPA--------------------------VKELSDDNFEHLTQASSGATTG 147
            .:.|.:.::....|:||                          |..||:.||:..      ..||
 Frog   254 RDLDSLKEYAESQLKPAEEKKEEEQKEDATPPQVEKPVAVESKVLSLSESNFDQT------VATG 312

  Fly   148 DWFIFFSSAECTVCQRLYAVWESVGGKLKRKLNIARMNSLESGISTA--TRLGVLEAPAFIFLRQ 210
            ..||.|.:..|..|:.|..:||.:..|....::..::..::.....|  .|..|...|..:..|.
 Frog   313 VSFIKFYAPWCGHCKNLVPIWEDLSKKEFSGMSDVKIAKVDCTAERALCNRFSVRGYPTLLLFRA 377

  Fly   211 GK 212
            |:
 Frog   378 GE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PTZ00102 27..>174 CDD:240266 34/155 (22%)
PTZ00443 125..302 CDD:185622 23/116 (20%)
txndc5NP_989186.1 PDI_a_ERp46 36..134 CDD:239303
PDI_a_ERp46 163..262 CDD:239303 16/72 (22%)
PDI_a_ERp46 296..397 CDD:239303 22/90 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.