DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and CG5554

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster


Alignment Length:218 Identity:45/218 - (20%)
Similarity:85/218 - (38%) Gaps:57/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LEPAVK--ELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKR-KLNIAR 183
            |:|..|  ||.:||:..:.|       |:|.|.|.:..|..|:.|...||......|. ::.:|:
  Fly    32 LQPGGKLIELDEDNWHLMLQ-------GEWMIEFFAPWCPACKNLAPTWERFARVAKDVQVQVAK 89

  Fly   184 MNSLESGISTATRLGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQFAEK---------------- 232
            :: :.:..|.:.|..|...|....::.|:..:|...: ..:|.:.|.:|                
  Fly    90 ID-VTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGAR-DGDALLYFVKKQQWQSIEPLSAWKKPD 152

  Fly   233 -------------GYTQSHPQPVPAIPSAVNEFLGPLQSYFAAENITSLATLSIFALVALLFVGK 284
                         .:|..|.|.:      ..:|.|.||..:   .:.:..:.::|| :|.:|||.
  Fly   153 TTHMSVLSYFFKLSHTLKHTQKL------FKDFNGRLQEEY---GLPTWGSYALFA-IATIFVGA 207

  Fly   285 KVAKI------FSSEPAKTKNKS 301
            .:..:      |...|.|::.:|
  Fly   208 ALGLLLVCLVDFVYPPKKSQRQS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 24/105 (23%)
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1481386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.