DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and Tmx1

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_006240240.1 Gene:Tmx1 / 362751 RGDID:1308455 Length:298 Species:Rattus norvegicus


Alignment Length:254 Identity:48/254 - (18%)
Similarity:91/254 - (35%) Gaps:83/254 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IQLLTGS--SNVVVLFNKNNCQRCVEYENMVTKIRAQLEETLSAIVVQSVDSNLVSIYDPSKEPA 93
            ::.:||.  |.:.|.|.:.|..:|..:..:|      :..::.|:|:    .|....|.|     
  Rat     1 METVTGKTLSVLAVSFQQRNTNQCCLFSVIV------MNSSVKAVVI----INSYVKYSP----- 50

  Fly    94 LVFFRRGIPILYHGEINDDEILDFFNDNLEPAVKELSDDNFEHL---TQASSGATTGDWFIFFSS 155
                                              .|.:|.|:|.   .:.:...:...|      
  Rat    51 ----------------------------------RLQEDTFKHFLLHCKCNIHKSYAPW------ 75

  Fly   156 AECTVCQRLYAVWESV---GGKLKRKLNIARMNSLE-SGISTATRLGVLEAPAFIFLRQGKMYKY 216
              |..||.|...|||.   |..|:.|  :|:::..| :|:|  .|..:...|:....:.|:..:|
  Rat    76 --CPACQNLQPEWESFAEWGEDLEVK--VAKVDVTEQTGLS--GRFIITALPSIYHCKDGEFRRY 134

  Fly   217 SAKQYSPEAFVQF-AEKGYTQSHPQPVPAIPSAVNEFLGPLQSYFAAENITSLATLSIF 274
            ...: :.:.|:.| :||.:....|         |:.:.||  |......:::|..||::
  Rat   135 LGPR-TKKDFINFISEKEWKNVEP---------VSSWFGP--SSVLMTTMSALFQLSVY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 25/110 (23%)
Tmx1XP_006240240.1 Thioredoxin_like <70..149 CDD:294274 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1481386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.