DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and CaBP1

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:319 Identity:62/319 - (19%)
Similarity:103/319 - (32%) Gaps:107/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHIVSVVIIALSLGCAVGQDLRRVDDTELIQLLTGSSNVVVLFNKNNCQR-------------- 51
            |..:.|::::|..:|.              :......|:.||....:|..|              
  Fly     1 MRQLASILLLAFVVGS--------------VSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFY 51

  Fly    52 ---CVEYENMVTKIRAQLEETLSAIV-VQSV----DSNLVSIYDPSKEPALVFF--RRGIPILYH 106
               |...:::|.:.: :|.:.|..:| |.||    ||.|...:.....|.:..|  .:..|..|:
  Fly    52 APWCGHCQSLVPEYK-KLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYN 115

  Fly   107 GEINDDEILDFFNDNLEPAVK-----------------------ELSDDNFEHLTQASSGATTGD 148
            |:.....|.:.....::..|:                       ||::|||:.|...|...    
  Fly   116 GQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDI---- 176

  Fly   149 WFIFFSSAECTVCQRLYAVWESVGGKLKRKLNIARMNSLESGISTATRLGVLEAPAFIFLRQGKM 213
            |.:.|.:..|..|:.|...|.....:||.|:                :||.|:|.|    .|.|.
  Fly   177 WLVEFFAPWCGHCKNLAPEWAKAAKELKGKV----------------KLGALDATA----HQSKA 221

  Fly   214 YKYSAKQYSPEAFVQFAEK----------GYTQS---------HPQ--PVPAIPSAVNE 251
            .:|:.:.|....|.....|          |.|.|         |..  |.|.:...:||
  Fly   222 AEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 26/125 (21%)
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 20/93 (22%)
PDI_a_P5 157..262 CDD:239299 30/128 (23%)
Thioredoxin_6 190..383 CDD:290560 24/111 (22%)
P5_C 271..400 CDD:239281 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.