DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and CG18132

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster


Alignment Length:170 Identity:38/170 - (22%)
Similarity:58/170 - (34%) Gaps:50/170 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DNLEP-AVKELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKRKLNI-- 181
            |...| .:.:|..|||...|:      .|.:|:.|....|..|......|..:....|.|.||  
  Fly    45 DQCTPGTILKLRVDNFFETTE------DGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICF 103

  Fly   182 ARMNS--------------------LESGISTATRLGVLEAPA---FIF--LRQGKMYKYSAKQY 221
            |.:|.                    ||:|.......|.|.:|.   |::  :|:.:..|.:||: 
  Fly   104 AELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKR- 167

  Fly   222 SPEAFVQFAEKGYTQSHPQPVPAIPSAVNEFLGPLQSYFA 261
                         ...|.:|:  |......:.|.:.||||
  Fly   168 -------------PYFHTKPI--ILFGWFLYAGDVISYFA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 28/129 (22%)
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.