DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and pdia6

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_922915.2 Gene:pdia6 / 322160 ZFINID:ZDB-GENE-030131-879 Length:440 Species:Danio rerio


Alignment Length:323 Identity:64/323 - (19%)
Similarity:108/323 - (33%) Gaps:111/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHIVSVVIIALSLGCAVGQDLRRVDDTELIQLLTGSSNVVVL----FNKNN------------- 48
            |..::.|:..:|::..|.|             |.|.|.:||.|    ||:..             
Zfish     1 MRALLGVLACSLTVLSAYG-------------LYTSSDDVVELNPSNFNREVIQSDSLWLVEFYA 52

  Fly    49 --CQRC----VEYENMVTKIRAQLEETLSAIVVQSVD----SNLVSIYDPSKEPALVFF--RRGI 101
              |..|    .|::...|.::       ..:.|.:||    ::|...|.....|.:..|  .:..
Zfish    53 PWCGHCKSLAPEWKKAATALK-------GIVKVGAVDADQHNSLGGQYGVRGFPTIKIFGGNKHK 110

  Fly   102 PILYHGEINDDEILDFFNDNLEPAVK---------------------------ELSDDNFEHLTQ 139
            |..|.|...:..|:|...:.|...||                           ||:||||:....
Zfish   111 PEDYQGGRTNQAIVDAALNALRSLVKDRLGGKTGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVL 175

  Fly   140 ASSGATTGDWFIFFSSAECTVCQRLYAVWESVGGKLKR----KLNIARMN-SLESGISTATRLGV 199
            .|...    |.:.|.:..|..|:.|...|.:...::|.    |:.:|..: ::..|:  |:|.|:
Zfish   176 ESDDV----WLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVRLAAEDATVHQGL--ASRFGI 234

  Fly   200 LEAPAFIFLRQGKMYKYSAKQYSPEAFVQFAEKGYTQ-----------SHPQPVPAIPSAVNE 251
            ...|.....|:|:         .||.:    :.|.|:           |...|.|.:...:||
Zfish   235 RGFPTIKVFRKGE---------EPEDY----QGGRTRSDIVARALELYSDNIPAPELQEVLNE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 26/134 (19%)
pdia6NP_922915.2 ER_PDI_fam 25..262 CDD:273457 51/262 (19%)
PDI_a_P5 26..128 CDD:239299 21/108 (19%)
PDI_a_P5 161..266 CDD:239299 27/123 (22%)
P5_C 275..404 CDD:239281 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.