DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and prtp

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:255 Identity:57/255 - (22%)
Similarity:99/255 - (38%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVSVVIIALSLG-------CAVGQDLRRVD-------DTELIQLLTGSSNVVVLFNKNNCQRCVE 54
            |:||.:..|.|.       .:..:|..:.|       |.|.........||.|.|....|..|  
  Fly     6 ILSVAVCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGNVFVKFFAPWCGHC-- 68

  Fly    55 YENMVTKIRAQLEETLSA----IVVQSVD----SNLVSIYDPSKEPALVFFRRG--IPILYHGEI 109
              ..:..:..||.|.::.    :::..||    ..|.:.:..:..|.|..|:.|  ..:.:.|..
  Fly    69 --KRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTR 131

  Fly   110 NDDEILDFFNDNLE-PAVKELSDDNFEHLTQASSG-------------ATTGDWFIFFSSAECTV 160
            :...|.||.|..|. ||..:|.:...|.:...:.|             .:||:.|:.|.:..|:.
  Fly   132 DLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNHFVKFFAPWCSH 196

  Fly   161 CQRLYAVWESVGGKLKRK--LNIARMNSLESGISTATRLGVLEAPAFIFLRQG-KMYKYS 217
            ||||...||.:..:|.::  :.|::::..:.. |......|...|..:::..| |:.|||
  Fly   197 CQRLAPTWEDLAKELIKEPTVTISKIDCTQFR-SICQDFEVKGYPTLLWIEDGKKIEKYS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 24/107 (22%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 21/105 (20%)
ER_PDI_fam 39..409 CDD:273457 50/222 (23%)
PDI_a_ERp46 167..267 CDD:239303 21/90 (23%)
PDI_a_ERp46 303..407 CDD:239303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.