DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and Erp27

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001100095.1 Gene:Erp27 / 297698 RGDID:1565381 Length:272 Species:Rattus norvegicus


Alignment Length:135 Identity:32/135 - (23%)
Similarity:57/135 - (42%) Gaps:35/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DLRRVDDTELIQLLTGSSNVVVLFNKNNCQRCVEYENMVTKIRAQLEETLSAIVVQSVDSNLVSI 85
            |...:||.:..:|    |..:.|   ||.....||..|   |.|.|..|:       |.::|:.|
  Rat   120 DAEDIDDLDAAKL----SRFIHL---NNLHWVTEYSPM---IGAGLFNTM-------VQTHLLLI 167

  Fly    86 YD---PSKEPALVFFRRGIPILYHGEI----------NDDEILDFF--NDNLEP--AVKELSDDN 133
            .:   |..|.:|..:::... |:.|:|          .:.:::.:|  .::..|  |:.|..||.
  Rat   168 MNKASPEYEESLRSYQKAAK-LFQGQILFVLVDSGKRENGKVIAYFRLKESQLPALAIYESVDDK 231

  Fly   134 FEHLT 138
            ::.||
  Rat   232 WDALT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 5/12 (42%)
Erp27NP_001100095.1 PDI_b_family 43..139 CDD:239279 6/25 (24%)
Thioredoxin_6 64..250 CDD:290560 32/135 (24%)
PDI_b'_family 156..253 CDD:239280 18/89 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.