DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and Pdia6

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001004442.1 Gene:Pdia6 / 286906 RGDID:628688 Length:445 Species:Rattus norvegicus


Alignment Length:316 Identity:59/316 - (18%)
Similarity:110/316 - (34%) Gaps:93/316 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LHIVSVVIIALSL-GC----AVGQDLRRVDDTELIQLLTGSSNVVVLFNKN------------NC 49
            :.::|:..:.|.| .|    ||.......||  :|:|...:.|..|:.:.:            :|
  Rat     1 MRVISMARLVLGLVSCTFFLAVSALYSSSDD--VIELTPSNFNREVIQSDSLWLVEFYAPWCGHC 63

  Fly    50 QRCV-EYENMVTKIRAQLEETLSAIVVQSVDS----NLVSIYDPSKEPALVFF--RRGIPILYHG 107
            ||.. |::...:.::       ..:.|.:|::    :|...|.....|.:..|  .:..|..|.|
  Rat    64 QRLTPEWKKAASALK-------DVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQG 121

  Fly   108 EINDDEILDFFNDNLEPAVK---------------------------ELSDDNFEHLTQASSGAT 145
            ....:.|:|.....|...||                           ||:||.|:.....|... 
  Rat   122 GRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDV- 185

  Fly   146 TGDWFIFFSSAECTVCQRLYAVWESVGGKLKR----KLNIARMNSLESGISTATRLGVLEAPAFI 206
               |.:.|.:..|..|:.|...|.:...::|.    |:.:|.:::..:.: .|:|.|:...|...
  Rat   186 ---WMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQV-LASRYGIKGFPTIK 246

  Fly   207 FLRQGKMYKYSAKQYSPEAFVQFAEKGYTQ-----------SHPQPVPAIPSAVNE 251
            ..::|:         ||..:    :.|.|:           |...|.|.:...:||
  Rat   247 IFQKGE---------SPVDY----DGGRTRSDIVSRALDLFSDNAPPPELLEIINE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 23/133 (17%)
Pdia6NP_001004442.1 PDI_a_P5 31..133 CDD:239299 20/110 (18%)
PDI_a_P5 166..271 CDD:239299 24/122 (20%)
P5_C 280..409 CDD:239281 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.