DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and PDILT

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_777584.1 Gene:PDILT / 204474 HGNCID:27338 Length:584 Species:Homo sapiens


Alignment Length:142 Identity:33/142 - (23%)
Similarity:58/142 - (40%) Gaps:37/142 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QDLRRVDDTELIQLLTGSSNVVVLFNKNN----------CQRCV-----------EYENMVTKIR 63
            :::.:..|..|::.|.|.:..||:|:|..          .::|.           :|:|..|.|.
Human   378 EEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIII 442

  Fly    64 AQLEETLSAIVVQSVDSNLVSIYDPSKEPALVFFRRGI--PILYHGEINDDEILDFFNDNLEPAV 126
            |:::.|.:.|.:..:|          :.|....|..|.  .:||.||    ..|..|:|.||..:
Human   443 AKIDVTANDIQLMYLD----------RYPFFRLFPSGSQQAVLYKGE----HTLKGFSDFLESHI 493

  Fly   127 KELSDDNFEHLT 138
            |...:|..|.|:
Human   494 KTKIEDEDELLS 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 4/12 (33%)
PDILTNP_777584.1 YbbN 46..501 CDD:331940 31/136 (23%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 581..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.