DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and pdi-6

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_509190.1 Gene:pdi-6 / 180974 WormBaseID:WBGene00015168 Length:440 Species:Caenorhabditis elegans


Alignment Length:334 Identity:62/334 - (18%)
Similarity:116/334 - (34%) Gaps:91/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVSVVIIALSLGCAVGQDLRRVDDTELIQL-----LTGSSNV-VVLFNKNNCQRCVEYENMVTKI 62
            ::.:::.:|::....|...::.|..||.:.     :..|.:: :|.|....|..|   :::|.:.
 Worm     3 LIKLLLASLAITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHC---KSLVPEY 64

  Fly    63 RAQLEETLSAIVVQSVD----SNLVSIYDPSKEPALVFF--RRGIPILYHGEINDDEILDFFNDN 121
            :...........|.:||    .::...|:....|.|..|  .:..|..|:|:.....|.|.....
 Worm    65 KKAASALKGVAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVLAE 129

  Fly   122 LEPAVK--------------------------------ELSDDNFEHLTQASSGATTGDWFIFFS 154
            .:.||.                                ||:|.|||.|...|...    |.:.|.
 Worm   130 AKKAVSARLGGKSSGSSSSGSGSGSGKRGGGGSGNEVVELTDANFEDLVLNSKDI----WLVEFF 190

  Fly   155 SAECTVCQRLYAVWESVGGKLKRKLNIARMNSLESGIST--ATRLGVLEAPAFIFLRQGKMYKYS 217
            :..|..|:.|...|::...:||.|:   |:.:|::.:.|  |.:..:...|             :
 Worm   191 APWCGHCKSLEPQWKAAASELKGKV---RLGALDATVHTVVANKFAIRGFP-------------T 239

  Fly   218 AKQYSPEAFVQFAE--KGYTQS------------HPQPVPAIPSAVNEFLGPLQSYFAAENITSL 268
            .|.::|.:.|..|:  .|..||            ...|.|.:...:|:.:        .|:....
 Worm   240 IKYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQENMPAPEVFEGINQQV--------VEDACKE 296

  Fly   269 ATLSIFALV 277
            ..|.|||.:
 Worm   297 KQLCIFAFL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 25/136 (18%)
pdi-6NP_509190.1 PDI_a_P5 25..127 CDD:239299 21/104 (20%)
PDI_a_P5 165..269 CDD:239299 29/123 (24%)
P5_C 278..407 CDD:239281 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.