DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and ERP27

DIOPT Version :10

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens


Alignment Length:153 Identity:36/153 - (23%)
Similarity:56/153 - (36%) Gaps:44/153 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QDLRRVDDTELIQLLTGSS----------NVVVLFNK----------NNCQRCVEYENMVTKIRA 64
            :|:..:|.|:|.:.:..:|          .|:.|||.          |...  .|||..:.:.:.
Human   122 EDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQIHLLLIMNKAS--PEYEENMHRYQK 184

  Fly    65 QLEETLSAIVVQSVDSNLVSIYDPSKEPALV--FFR---RGIPILYHGEINDDEILDFFNDNLEP 124
            ..:.....|:...|||.:       ||...|  ||:   ..:|.|...:..|||.     |.|..
Human   185 AAKLFQGKILFILVDSGM-------KENGKVISFFKLKESQLPALAIYQTLDDEW-----DTLPT 237

  Fly   125 AVKELSDDNFEHLTQASSGATTG 147
            |  |:|   .||:.....|..:|
Human   238 A--EVS---VEHVQNFCDGFLSG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PTZ00102 27..>174 CDD:240266 34/146 (23%)
PTZ00443 125..302 CDD:185622 7/23 (30%)
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:463999 34/146 (23%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 2/7 (29%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.