DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and PDIA5

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_006801.1 Gene:PDIA5 / 10954 HGNCID:24811 Length:519 Species:Homo sapiens


Alignment Length:290 Identity:57/290 - (19%)
Similarity:109/290 - (37%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHIVSVVIIALSLGCAVGQDLRRVDD-TELIQLLTGSSNVVVLFNKNNCQRCVEYENMVTKIRA 64
            :|..:.||:.:......|...:.|:.| .:|.:||...:||:||::|             :::.|
Human     9 LLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSK-------------SEVAA 60

  Fly    65 QLEETLSAIVVQSVDSN--------------------LVSIYDPSKEPALVFFRRGIPILYHGEI 109
            :....|.:.|.|:|...                    .|.:....|:..|..::.|   .:|.|.
Human    61 ENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDG---AFHTEY 122

  Fly   110 ND----DEILDFFND-------NLEPAVKEL----SDDNFEHLTQASSGATTGDWFIFFSSAECT 159
            |.    ..|:.|..|       ..:|..|::    |:.:|..|.:......    .|.|.:..|:
Human   123 NRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPL----LIMFYAPWCS 183

  Fly   160 VCQRLYAVWESVGGKLKRKLNIARMNSLESGI-STATRLGVLEAPAFIFLRQGK-MYKYSAKQYS 222
            :|:|:...::....:|:....:|.||...|.. :......|...|...:..:|: :::|.....:
Human   184 MCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGST 248

  Fly   223 PEAFVQFAEKGYTQSHPQP----VPAIPSA 248
            .|..|::.:      :|||    ||..|.|
Human   249 AEDIVEWLK------NPQPPQPQVPETPWA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 20/108 (19%)
PDIA5NP_006801.1 PDI_b_PDIR_N 28..139 CDD:239365 25/126 (20%)
PDI_a_PDIR 152..256 CDD:239295 19/107 (18%)
PTZ00102 168..512 CDD:240266 23/115 (20%)
PDI_a_PDIR 277..379 CDD:239295
PDI_a_PDIR 398..501 CDD:239295
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 516..519
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.