DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and Txndc5

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_663342.3 Gene:Txndc5 / 105245 MGIID:2145316 Length:417 Species:Mus musculus


Alignment Length:305 Identity:70/305 - (22%)
Similarity:118/305 - (38%) Gaps:67/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVVIIALSLGCAVGQDLRRVD-------DTELIQLLT---------GSSNVVVLFNK--NNCQRC 52
            ::..:.|.||...|...:.|:       |.....|.|         .:::.|:.|..  .:|||.
Mouse    17 ALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRL 81

  Fly    53 VEYENMVTKIRAQLEETLSAIVVQSV----DSNLVSIYDPSKEPALVFFRRG-IPILYHG----E 108
            ....|.:......:|:  :.:.|..|    ||::.|.......|.|.||:.| ..:.|.|    |
Mouse    82 QPTWNDLGDKYNSMED--AKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFE 144

  Fly   109 INDDEILDFFNDNLEPA-----------------VKELSDDNFE-HLTQASSGATTGDWFIFFSS 155
            ..::.:|...|:  |||                 :.|||.:||| |::|       |:.||.|.:
Mouse   145 TLENWMLQTLNE--EPATPEPEAEPPRAPELKQGLYELSANNFELHVSQ-------GNHFIKFFA 200

  Fly   156 AECTVCQRLYAVWE--SVGGKLKRKLNIARMNSLESGISTATRLGVLEAPAFIFLRQGKMYKYSA 218
            ..|..|:.|...||  ::|.:....:.|.:::..:. .:..:...|...|..::.|.||    ..
Mouse   201 PWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQH-YAVCSEHQVRGYPTLLWFRDGK----KV 260

  Fly   219 KQYSPEAFVQFAEKGYTQSHPQPVPAIPSAVNEFLGPLQSYFAAE 263
            .||..:..:: :.:.|.||..|...|.|..|.....|:   .|||
Mouse   261 DQYKGKRDLE-SLRDYVQSQLQGSEAAPETVEPSEAPV---MAAE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 26/105 (25%)
Txndc5NP_663342.3 PDI_a_ERp46 47..150 CDD:239303 22/104 (21%)
ER_PDI_fam 52..417 CDD:273457 63/270 (23%)
PDI_a_ERp46 176..276 CDD:239303 26/112 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..302 8/24 (33%)
PDI_a_ERp46 308..409 CDD:239303
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.