DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11790 and PDIA6

DIOPT Version :9

Sequence 1:NP_651326.1 Gene:CG11790 / 42999 FlyBaseID:FBgn0039265 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001269633.1 Gene:PDIA6 / 10130 HGNCID:30168 Length:492 Species:Homo sapiens


Alignment Length:290 Identity:55/290 - (18%)
Similarity:98/290 - (33%) Gaps:96/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LLTGSSNVVVL----FNK------------------NNCQRCV-EYENMVTKIRAQLEETLSAIV 74
            |.:.|.:|:.|    ||:                  .:|||.. |::...|.::       ..:.
Human    72 LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALK-------DVVK 129

  Fly    75 VQSVDS----NLVSIYDPSKEPALVFF--RRGIPILYHGEINDDEILDFFNDNLEPAVK------ 127
            |.:||:    :|...|.....|.:..|  .:..|..|.|....:.|:|.....|...||      
Human   130 VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGR 194

  Fly   128 ---------------------ELSDDNFEHLTQASSGATTGDWFIFFSSAECTVCQRLYAVWESV 171
                                 ||:||:|:.....|...    |.:.|.:..|..|:.|...|.:.
Human   195 SGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDV----WMVEFYAPWCGHCKNLEPEWAAA 255

  Fly   172 GGKLKR----KLNIARMNSLESGISTATRLGVLEAPAFIFLRQGKMYKYSAKQYSPEAFVQFAEK 232
            ..::|.    |:.:|.:::..:.: .|:|.|:...|.....::|:         ||..:    :.
Human   256 ASEVKEQTKGKVKLAAVDATVNQV-LASRYGIRGFPTIKIFQKGE---------SPVDY----DG 306

  Fly   233 GYTQ-----------SHPQPVPAIPSAVNE 251
            |.|:           |...|.|.:...:||
Human   307 GRTRSDIVSRALDLFSDNAPPPELLEIINE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11790NP_651326.1 PDI_a_family 127..230 CDD:239259 23/133 (17%)
PDIA6NP_001269633.1 PDI_a_P5 78..180 CDD:239299 21/108 (19%)
PDI_a_P5 213..318 CDD:239299 24/122 (20%)
P5_C 327..456 CDD:239281 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.