DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11786 and CNTRL

DIOPT Version :10

Sequence 1:NP_001097906.1 Gene:CG11786 / 42998 FlyBaseID:FBgn0039264 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_047278623.1 Gene:CNTRL / 11064 HGNCID:1858 Length:2359 Species:Homo sapiens


Alignment Length:127 Identity:46/127 - (36%)
Similarity:55/127 - (43%) Gaps:38/127 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DSGGYSY-SSPPSNSYLPPATPAPEYL---------PPPNNGYQYNPPPNNNYLPPPNNN--YLP 91
            ||||.|. .|...:...||..|.|.|:         |.|.....|.|||     |.|||:  ..|
Human  1238 DSGGDSQEESELDDQEEPPFVPPPGYMMYTVLPDGSPVPQGMALYAPPP-----PLPNNSRPLTP 1297

  Fly    92 PPPEYG-PPAGYPS-YGPPPPPFYKPAPFIP----------YHSHDS-------ILEKLKSK 134
            ....|| ||||.|. ||||||.|  ..||||          :|:.::       |::.||||
Human  1298 GTVVYGPPPAGAPMVYGPPPPNF--SIPFIPMGVLHCNVPEHHNLENEVSRLEDIMQHLKSK 1357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11786NP_001097906.1 None
CNTRLXP_047278623.1 leucine-rich repeat 195..219 CDD:275380
leucine-rich repeat 220..246 CDD:275380
Smc <454..1077 CDD:440809
SMC_prok_B 1365..2239 CDD:274008
PPP1R42 89..261 CDD:455733
leucine-rich repeat 100..119 CDD:275378
leucine-rich repeat 127..148 CDD:275380
leucine-rich repeat 149..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.