DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bai and ERP5

DIOPT Version :9

Sequence 1:NP_651323.3 Gene:bai / 42996 FlyBaseID:FBgn0045866 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_011978.1 Gene:ERP5 / 856510 SGDID:S000001152 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:55/227 - (24%)
Similarity:100/227 - (44%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCLLMACAWSSHAVMFKLSPNTQKCLKEDIQANQLVMGEFEVSDVPGQIIDYIAR---------- 62
            :|||.|...:..||.|.......||..|.:....|::|:.::         |:.:          
Yeast     9 ICLLFAITQAVGAVHFYAKSGETKCFYEHLSRGNLLIGDLDL---------YVEKDGLFEEDPES 64

  Fly    63 ----------DTKGHILSQKEHITKGKFSFMSEVYDTYEIC---FISKVPAHQRGVIQ-EV---- 109
                      |....:|:||...| |..:|.:.....:..|   |.||..|..|..|: |:    
Yeast    65 SLTITVDETFDNDHRVLNQKNSHT-GDVTFTALDTGEHRFCFTPFYSKKSATLRVFIELEIGNVE 128

  Fly   110 SLLTKKGVETKSYEG-IGEASKLKPLEVDLKRLEDLSDSIVRDFVLMRKREEEMRDTNEKTNSRV 173
            :|.:||..:..|.:| :|:.:         :||    .||.::...:|::|.|.|:.:|..||::
Yeast   129 ALDSKKKEDMNSLKGRVGQLT---------QRL----SSIRKEQDAIREKEAEFRNQSESANSKI 180

  Fly   174 LFFSIFSMCCLLGLATWQVLYLRRYFKAKKLI 205
            :.:|:|.:..|||...:|:.||:.:|..:|::
Yeast   181 MTWSVFQLLILLGTCAFQLRYLKNFFVKQKVV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
baiNP_651323.3 EMP24_GP25L 20..200 CDD:279450 49/208 (24%)
ERP5NP_011978.1 EMP24_GP25L 21..206 CDD:395878 49/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.